PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D12G1237
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 225aa    MW: 26265.2 Da    PI: 5.0513
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D12G1237genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.6e-17552148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd  l+ +v+++G g+W++ ar  g++Rt+k+c++rw++yl
      Gh_D12G1237  5 KGQWTEEEDSMLKAYVTLHGEGRWNSAARFSGLRRTGKSCRLRWLNYL 52
                     799*******************************************97 PP

2Myb_DNA-binding50.64.3e-1658101146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T eE++l+++++  +G++ W++Ia++++ gRt++++k++w++
      Gh_D12G1237  58 RGSITLEEQLLIIQLHSIWGNR-WSKIAEHLP-GRTDNEIKNYWRT 101
                      7889******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.2156IPR017930Myb domain
SuperFamilySSF466894.87E-30299IPR009057Homeodomain-like
SMARTSM007171.1E-12454IPR001005SANT/Myb domain
PfamPF002492.3E-14552IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-21659IPR009057Homeodomain-like
CDDcd001671.46E-9852No hitNo description
SMARTSM007175.2E-1557105IPR001005SANT/Myb domain
PROSITE profilePS5129419.86457107IPR017930Myb domain
PfamPF002498.7E-1558101IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-2260106IPR009057Homeodomain-like
CDDcd001671.54E-1062101No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MDVRKGQWTE EEDSMLKAYV TLHGEGRWNS AARFSGLRRT GKSCRLRWLN YLRPAVRRGS  60
ITLEEQLLII QLHSIWGNRW SKIAEHLPGR TDNEIKNYWR TKVQKQAKKL ECDVNSPKFR  120
DALRYEYTPR LIEQISRAKH ESPSGQLTYG NETESVQVDQ ILLPESSSET QVTYGSTVAE  180
TWGIDEQSNG NGWLGGGDYW MESEWCEENI WFLQQQLYDD EDDVI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-2321074108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6094282e-93JX609428.1 Gossypium hirsutum clone NBRI_GE50656 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012437940.11e-165PREDICTED: transcription factor MYB108-like isoform X1
SwissprotQ9LDE16e-61MY108_ARATH; Transcription factor MYB108
TrEMBLA0A0D2U2Q31e-165A0A0D2U2Q3_G
STRINGVIT_07s0005g01950.t018e-76(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48000.14e-67myb domain protein 112